PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G00470.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 515aa    MW: 56329.1 Da    PI: 7.4639
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G00470.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-083033401954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+  ++  LA+++gL+ +qV++WF N R +
  OGLUM06G00470.2 303 FEHflHPYPNDVDKHILARQTGLSRSQVSNWFINARVR 340
                      554459******************************88 PP

2BELL60.73.4e-201792272472
             BELL  24 kqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         ve++++v  sFeavag g+a++Yt+lA++a+SrhFrcL+da+++q+
  OGLUM06G00470.2 179 LSMVEEMRAVEVSFEAVAGGGAAQVYTKLAMRAMSRHFRCLRDALVGQV 227
                      55789*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-54101225IPR006563POX domain
PfamPF075266.3E-26107223IPR006563POX domain
PROSITE profilePS5007111.564281344IPR001356Homeobox domain
CDDcd000866.33E-12284345No hitNo description
SMARTSM003896.5E-9284348IPR001356Homeobox domain
SuperFamilySSF466895.99E-17285351IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-27287350IPR009057Homeodomain-like
PfamPF059202.4E-17301340IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MMAAHHHHHE HHHLLDMSSP PNASGAIISS FDHAAGLLSL HDVAAAADHH HHHLRGGGGG  60
LQLPSPWSQQ QVSLSLYNNA AGAAGSPPSS LVAHQQLAAA QPLMFQLRGS KYLGPVKALL  120
AEFCSLDVEA MDGAKQQRAP NPNPKIGKWD DVEGSGSWGN LSLSSMDLLD LERRKARILS  180
MVEEMRAVEV SFEAVAGGGA AQVYTKLAMR AMSRHFRCLR DALVGQVRAL RNAMGESQRD  240
AAGGVAAAAP GATKGDTPRL RVLDQCLRQQ RAFQQSGAVD SFPWRPQRGL PERAVAVLRA  300
WLFEHFLHPY PNDVDKHILA RQTGLSRSQV SNWFINARVR LWKPMIEDMY KEETKPESSD  360
GNNKLNPSAA GNKQQHRDDP KKNYTATTAE ASLVQQSSYH LHLRSRGNPN SSSLMIPAAA  420
STSIDHHHDS SHQLLGGHSY SSAAGLHHGH GGAVSLTLGL QQQQQPFAAS MMHQHQQQQQ  480
QQQQSFMVEA AEEEEDDVLP YRNLMESQLL HDFAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-15290347158Homeobox protein Meis1
4xrs_A2e-15290347158Homeobox protein Meis1
3k2a_B3e-15290347562Homeobox protein Meis2
3k2a_A3e-15290347562Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2188950.0AB218895.1 Oryza sativa Japonica Group mRNA for OsBEL protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641004.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLA0A0E0A3Z50.0A0A0E0A3Z5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA022158-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.14e-84TALE family protein